FOXO4-DRI Injectable
FOXO4-DRI 10 mg contains the D-retro-inverso isoform of the FOXO4 peptide, a cell-permeable senolytic agent designed to disrupt the FOXO4-p53 interaction. The peptide sequence incorporates D-amino acids to resist proteolytic degradation, with the sequence D-(LTLRKEPASEIAQSILEAYSQNGWANRRSGGKRPPPRRRQRRKKRG). It functions as a specific blocker of FOXO4 binding to p53, targeting the p53 transactivation domain.
In research contexts, FOXO4-DRI is investigated for its ability to selectively induce apoptosis in senescent cells while sparing normal cells. Preclinical studies have demonstrated that it causes nuclear exclusion of active p53 in senescent cells, leading to caspase-dependent apoptosis. Animal models have shown improvements in age-related conditions including testosterone secretion insufficiency in aged mice through clearance of senescent Leydig cells.
In longevity and bodybuilding-adjacent communities, FOXO4-DRI is referenced as a senolytic compound for periodic clearance of accumulated senescent cells. However, no human clinical trials have evaluated its safety or efficacy, and all available data comes from in vitro studies and mouse models. Such use falls outside any approved indication.
Research Properties of FOXO4-DRI 10 mg
- D-retro-inverso peptide resistant to proteolytic degradation
- Disrupts FOXO4-p53 interaction to induce senescent cell apoptosis
- Selectively targets senescent cells without affecting normal cells
- Investigated in aged animal models for tissue rejuvenation
- 10 mg per vial for research applications
Senolytic Peptide (FOXO4-p53 Interaction Blocker)
FOXO4-DRI belongs to the emerging class of senolytic compounds designed to selectively eliminate senescent cells. The peptide acts by competitively binding to the p53 transactivation domain, disrupting the FOXO4-p53 interaction that maintains senescent cell viability.
The D-retro-inverso configuration confers resistance to protease degradation, allowing the peptide to persist longer in biological systems than all-L peptides. Solution NMR studies have revealed that FOXO4-DRI binds to the disordered p53TAD2 region, forming a transiently folded complex.
In senescent cells, this disruption causes nuclear exclusion of p53, triggering apoptosis through a caspase-dependent mechanism. Research in aged mice has demonstrated that FOXO4-DRI treatment improves testicular microenvironment and alleviates age-related testosterone secretion insufficiency.
Defining Characteristic
Selective Senescent Cell Clearance
FOXO4-DRI's defining research characteristic is its ability to selectively induce apoptosis in senescent cells while sparing non-senescent cells. This mechanism targets the FOXO4-p53 interaction that is upregulated in senescent cells.
FOXO4-DRI 10 mg vs Other Dragon Pharma Preparations
Dragon Pharma offers several peptides referenced in longevity and recovery research contexts with different mechanisms. Epitalon is studied for telomerase activity and pineal regulation, while Humanin is investigated for mitochondrial-derived cytoprotection. FOXO4-DRI's mechanism targeting senescent cell clearance through FOXO4-p53 disruption is unique among these compounds.
Typical Dosage Ranges
No validated human clinical dose exists for FOXO4-DRI. Preclinical mouse studies used 5 mg/kg intraperitoneally every other day for three administrations. Community protocols reference 1–2 mg/kg subcutaneously, but these are extrapolations without human safety or efficacy data.
| Use Case |
Common Reference Range |
Frequency |
| Preclinical (mouse studies) |
5 mg/kg |
Every other day × 3 doses |
| Community protocol (unverified) |
1–2 mg/kg |
Variable, cycle-dependent |
Reconstitution & Handling
FOXO4-DRI 10 mg is supplied as a lyophilized powder requiring reconstitution. Bacteriostatic Water is commonly referenced for reconstituting research peptides. A 10 mg vial reconstituted with 2 mL yields a concentration of 5 mg/mL. Add solvent slowly along the vial wall and swirl gently. Do not shake. Store reconstituted solution at 2–8°C and use within 4 weeks.
Stacking & Research Considerations
In community research contexts, FOXO4-DRI is sometimes referenced alongside other senolytic compounds in longevity stacks. However, no controlled studies have examined combination protocols. FOXO4-DRI engages the p53 apoptotic axis, and interaction with other compounds affecting apoptosis or cell survival is not well understood.
Important
Individual Response Varies
The information above is for educational reference and does not constitute medical advice. FOXO4-DRI has not been evaluated by the FDA for safety or efficacy in humans.
Important Safety Information
FOXO4-DRI has never been tested in human clinical trials. No Phase 1 safety data, no human pharmacokinetic studies, and no long-term safety follow-up exist. All available data comes from in vitro experiments and mouse models.
Important
Non-Medical Use
Non-medical use of FOXO4-DRI falls outside any approved indication. No population exists for whom use of this compound is supported by evidence, and gray-market products are not manufactured under pharmaceutical standards.
Potential Adverse Effects
Theoretical safety concerns include off-target effects on p53 signaling in normal cells, potential impact on tissue integrity if senescent cells serve structural roles, and unknown long-term consequences of repeated senescent cell clearance. Transient neutropenia has been noted as a dose-limiting signal in mouse studies. No human safety profile has been established.
Conditions Requiring Medical Evaluation
Theoretical cautions include active infection (due to transient neutropenia window), recent surgery or injury (senescent cells play roles in wound healing), active or recent malignancy, and pregnancy or attempting conception. No formal contraindication list exists for human use because no approved indication exists.
Monitoring Considerations
Community protocols reference monitoring of CBC (particularly neutrophils), inflammatory markers (hs-CRP, IL-6), and testosterone levels where relevant. However, no standardized monitoring protocol exists, and reference ranges for non-medical contexts are not established.
Product Care
Storage & Handling
Store lyophilized powder at -20°C or colder, protected from light and moisture. After reconstitution, store at 2–8°C and use within 4 weeks. Avoid repeated freeze-thaw cycles, which accelerate peptide degradation.
Keep all research peptides and injectable products out of the reach of children.
Further Safety Information
USA Domestic 3–5 business days
International 10–15 business days
Order Processing 24–48 business hours
Tracking Provided after dispatch
Direct Supply
Discreet Delivery & Original Packaging
The outer shipping package remains discreet, with no external product details. Products are supplied through the official Dragon Pharma distribution chain.
What to Expect
- Orders are processed after payment confirmation
- USA Domestic shipping is typically faster when local stock is available
- International orders include tracking, though update frequency may vary by destination
- Multiple warehouses may result in separate shipments when applicable
Authenticity Verification
To verify your FOXO4-DRI 10 mg product, use the security code on the vial label and cross-check it on the official Dragon Pharma site. Original packaging and batch documentation help reinforce product legitimacy.
For complete delivery details, tracking policy, and reshipment terms, please see our Shipping Info page.
Recommended Conditions
Store lyophilized powder at -20°C or colder, protected from light and moisture. For long-term storage, -80°C is recommended. The unopened vial should be kept under conditions that preserve the peptide's structural integrity until reconstitution.
Once reconstituted, FOXO4-DRI solution should be stored at 2–8°C and used within 4 weeks. Do not freeze reconstituted solution. Discard if solution becomes cloudy or develops particulate matter.
Keep out of reach of children. Follow proper handling practices for research peptides and use appropriate sterile technique during reconstitution.
Quick Reference
Do & Don't
- Do store lyophilized powder at -20°C or colder
- Do protect from light and moisture
- Do use reconstituted solution within 4 weeks
- Don't freeze reconstituted solution
- Don't expose to excessive heat
- Don't use if powder appears discolored
What is FOXO4-DRI 10 mg used for?
FOXO4-DRI 10 mg is a research peptide supplied as a lyophilized powder. It contains a senolytic peptide that disrupts the FOXO4-p53 interaction to selectively induce apoptosis in senescent cells. There is no FDA-approved human indication for FOXO4-DRI.
How often should FOXO4-DRI 10 mg be administered?
No validated human dosing protocol exists. Preclinical mouse studies used 5 mg/kg intraperitoneally every other day for three administrations. Community protocols reference 1–2 mg/kg subcutaneously, but these are extrapolations without human safety data.
Does FOXO4-DRI 10 mg require PCT?
FOXO4-DRI is not an anabolic steroid and does not suppress endogenous testosterone production. Post-cycle therapy designed for steroid cycles is not applicable. Its mechanism involves senescent cell clearance through FOXO4-p53 disruption, not hormonal pathways.
What does FOXO4-DRI do?
FOXO4-DRI competitively binds to the p53 transactivation domain, disrupting the FOXO4-p53 interaction that maintains senescent cell viability. This causes nuclear exclusion of p53 and triggers apoptosis specifically in senescent cells.
How long does FOXO4-DRI take to work?
No established onset timeline exists for FOXO4-DRI in humans because no clinical trials have been completed. In mouse studies, outcomes were assessed 30 days after a short dosing cycle, suggesting effects on senescent cell clearance persist after the peptide leaves the system.
Is FOXO4-DRI the best senolytic peptide?
No single senolytic peptide is universally superior. FOXO4-DRI's research profile focuses on FOXO4-p53 interaction blocking, while other senolytics like navitoclax have different mechanisms and some human trial data. Appropriate selection depends on the specific research context.
What is the difference between FOXO4-DRI and Epitalon?
Epitalon is a tetrapeptide studied for telomerase activation and pineal regulation. FOXO4-DRI is a senolytic peptide that targets the FOXO4-p53 interaction to clear senescent cells. Their mechanisms and research applications are fundamentally different.
What is the difference between FOXO4-DRI and Humanin?
Humanin is a mitochondrial-derived peptide investigated for anti-apoptotic cytoprotective effects. FOXO4-DRI induces apoptosis in senescent cells through FOXO4-p53 disruption. These compounds have opposing effects on apoptosis pathways.
Is 10 mg of FOXO4-DRI a lot?
10 mg is the total labeled content of the FOXO4-DRI 10 mg vial. Because no standardized human dosage exists for this research peptide, the milligram amount cannot be classified as high or low relative to established protocols. Preclinical doses are in the mg/kg range.
What strength is FOXO4-DRI 10 mg?
FOXO4-DRI 10 mg by Dragon Pharma contains 10 mg of FOXO4-DRI per vial as a lyophilized powder. The vial size is 2 mL. This is a research presentation.
Can FOXO4-DRI be stacked with other peptides?
There is no established research on combining FOXO4-DRI with other peptides. In community longevity stacks, it is sometimes referenced alongside other senolytic or anti-aging compounds, but no controlled studies support these combinations.
No reviews found
Please log in to write FOXO4-DRI 10 mg review.
